PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0091s0380.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 205aa    MW: 22560.4 Da    PI: 8.6243
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0091s0380.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702100.43.2e-31975473
                  DUF702  4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaask 73
                            g+++Cq+CGnqakkdCa++RCRtCC+s+gf+C+thvkstWvpa krr+r q+l   ++++ + +   ++k
  SapurV1A.0091s0380.1.p  9 GGSRCQECGNQAKKDCAYMRCRTCCNSKGFQCQTHVKSTWVPACKRRQRAQNLLPIQQQQVQGH---NPK 75
                            6789*********************************************988888777665543...222 PP

2DUF70275.21.9e-237113986154
                  DUF702  86 lsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                              ++ k  +++++  le++++P+ev+s+  frc rvss+d++ +++aYqt+v+igG vfkGiLydqG++e
  SapurV1A.0091s0380.1.p  71 GHNPKRRRENPSAGLEIENFPAEVNSTVTFRCFRVSSIDESIDQFAYQTSVNIGGRVFKGILYDQGPHE 139
                             4455556677888999999***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.1E-5310138IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.7E-251354IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.5E-2190137IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MIRQGCDLGG SRCQECGNQA KKDCAYMRCR TCCNSKGFQC QTHVKSTWVP ACKRRQRAQN  60
LLPIQQQQVQ GHNPKRRREN PSAGLEIENF PAEVNSTVTF RCFRVSSIDE SIDQFAYQTS  120
VNIGGRVFKG ILYDQGPHES CYYFGESSSR QLHEPHLPSA DALITRPGTL ASASGAAESL  180
APPSYPFPLA ASMSGTQLFL HPKS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037177.11e-124PREDICTED: protein SHORT INTERNODES-like
RefseqXP_011037178.11e-124PREDICTED: protein SHORT INTERNODES-like
RefseqXP_011037179.11e-124PREDICTED: protein SHORT INTERNODES-like
SwissprotQ9XGX01e-55SHI_ARATH; Protein SHORT INTERNODES
TrEMBLB9H0V91e-122B9H0V9_POPTR; Lateral root primordium family protein (Fragment)
STRINGPOPTR_0004s16770.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99692541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.19e-49Lateral root primordium (LRP) protein-related